Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Absidia glauca Actin-1 (ACT1), partial

Recombinant Absidia glauca Actin-1 (ACT1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Absidia glauca (Pin mould) . Target Name: ACT1. Target Synonyms: ACT1Actin-1; Fragment. Accession Number: P10982. Expression Region: 1~140aa. Tag Info: N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Absidia glauca Actin-1 (ACT1), partial is a purified Recombinant Protein.

Accession Number

P10982

Expression Region

1~140aa

Host

E. coli

Target

ACT1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ACT1Actin-1; Fragment

Species

Absidia glauca (Pin mould)

Protein Name

Recombinant Protein

AA Sequence

MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucocorticoid Receptor (GCR) (PE) discontinued
G3030-08-PE 100 µL

Glucocorticoid Receptor (GCR) (PE) discontinued

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)
MBS2061661-01 0.1 mL

FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)
MBS2061661-02 0.2 mL

FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)
MBS2061661-03 0.5 mL

FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)
MBS2061661-04 1 mL

FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)
MBS2061661-05 5 mL

FITC-Linked Polyclonal Antibody to Toll Like Receptor 3 (TLR3)

Sign In for Pricing
View Details