Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C4-B (C4B), partial

Recombinant Human Complement C4-B (C4B), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: C4B. Target Synonyms: Basic complement C4C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3. Accession Number: P0C0L5. Expression Region: 1454~1744aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 49.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Complement C4-B (C4B), partial is a purified Recombinant Protein.

Accession Number

P0C0L5

Expression Region

1454~1744aa

Host

E. coli

Target

C4B

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

49.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Basic complement C4C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein
MBS1007316-01 0.02 mg (E-Coli)

Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein

Sign In for Pricing
View Details
Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein
MBS1007316-02 0.1 mg (E-Coli)

Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein

Sign In for Pricing
View Details
Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein
MBS1007316-03 0.02 mg (Yeast)

Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein

Sign In for Pricing
View Details
Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein
MBS1007316-04 0.1 mg (Yeast)

Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein

Sign In for Pricing
View Details
Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein
MBS1007316-05 0.02 mg (Baculovirus)

Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein

Sign In for Pricing
View Details
Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein
MBS1007316-06 0.02 mg (Mammalian-Cell)

Recombinant Human adenovirus F serotype 40 Early E1A 27 kDa protein

Sign In for Pricing
View Details