Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Apium graveolens (Celery) . Target Name: Apium graveolens Major allergen Api g 1, isoallergen 2. Target Synonyms: Major allergen Api g 1; isoallergen 2; Allergen Api g 1.0201; allergen Api g 1. Accession Number: P92918. Expression Region: 1~159aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2 is a purified Recombinant Protein.

Accession Number

P92918

Expression Region

1~159aa

Host

E. coli

Target

Apium graveolens Major allergen Api g 1, isoallergen 2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Major allergen Api g 1; isoallergen 2; Allergen Api g 1.0201; allergen Api g 1

Species

Apium graveolens (Celery)

Protein Name

Recombinant Protein

AA Sequence

MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Carm1 (BC036974) Mouse Tagged ORF Clone
MG209145 10 µg

Carm1 (BC036974) Mouse Tagged ORF Clone

Ask
View Details
BHLHB5, ID (BHLHE22, BHLHB5, TNRC20, Class E basic helix-loop-helix protein 22, Class B basic helix-loop-helix protein 5, Trinucleotide repeat-containing gene 20 protein) (MaxLight 650)
MBS6278370-01 0.1 mL

BHLHB5, ID (BHLHE22, BHLHB5, TNRC20, Class E basic helix-loop-helix protein 22, Class B basic helix-loop-helix protein 5, Trinucleotide repeat-containing gene 20 protein) (MaxLight 650)

Ask
View Details
BHLHB5, ID (BHLHE22, BHLHB5, TNRC20, Class E basic helix-loop-helix protein 22, Class B basic helix-loop-helix protein 5, Trinucleotide repeat-containing gene 20 protein) (MaxLight 650)
MBS6278370-02 5x 0.1 mL

BHLHB5, ID (BHLHE22, BHLHB5, TNRC20, Class E basic helix-loop-helix protein 22, Class B basic helix-loop-helix protein 5, Trinucleotide repeat-containing gene 20 protein) (MaxLight 650)

Ask
View Details
Phf1 Rat siRNA Oligo Duplex (Locus ID 294287)
SR511194 1 Kit

Phf1 Rat siRNA Oligo Duplex (Locus ID 294287)

Ask
View Details
ANXA3, ID (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3) (Biotin) discontinued
A2295-28C-Biotin 200 µL

ANXA3, ID (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3) (Biotin) discontinued

Ask
View Details
Rabbit Polyclonal (IgG) to Human UCP1 / UCP-1
MBS248170-01 0.05 mg

Rabbit Polyclonal (IgG) to Human UCP1 / UCP-1

Ask
View Details