Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avena sativa Endochitinase

Recombinant Avena sativa Endochitinase is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Avena sativa (Oat) . Target Name: Avena sativa Endochitinase. Target Synonyms: Endochitinase; EC 3.2.1.14; Fragments. Accession Number: P86181. Expression Region: 1~200aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Avena sativa Endochitinase is a purified Recombinant Protein.

Accession Number

P86181

Expression Region

1~200aa

Host

E. coli

Target

Avena sativa Endochitinase

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

25.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Endochitinase; EC 3.2.1.14; Fragments

Species

Avena sativa (Oat)

Protein Name

Recombinant Protein

AA Sequence

VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WDR5 Antibody Picoband®, Dylight550 Conjugate
A01910-3-Dylight550 100 µg

Anti-WDR5 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
ESE1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-62306R-PE-Cy7 100 µL

ESE1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Lactobacillus sakei subsp. sakei DNA ligase (ligA), partial
MBS1329592 Inquire

Recombinant Lactobacillus sakei subsp. sakei DNA ligase (ligA), partial

Sign In for Pricing
View Details
HRASLS3, CT (PLA2G16, HRASLS3, HREV107, Group XVI phospholipase A1/A2, Adipose-specific phospholipase A2, H-rev 107 protein homolog, HRAS-like suppressor 1, HRAS-like suppressor 3, HREV107-1, HREV107-3, Renal carcinoma antigen NY-REN-65) (MaxLight 550)
MBS6308338-01 0.1 mL

HRASLS3, CT (PLA2G16, HRASLS3, HREV107, Group XVI phospholipase A1/A2, Adipose-specific phospholipase A2, H-rev 107 protein homolog, HRAS-like suppressor 1, HRAS-like suppressor 3, HREV107-1, HREV107-3, Renal carcinoma antigen NY-REN-65) (MaxLight 550)

Sign In for Pricing
View Details
HRASLS3, CT (PLA2G16, HRASLS3, HREV107, Group XVI phospholipase A1/A2, Adipose-specific phospholipase A2, H-rev 107 protein homolog, HRAS-like suppressor 1, HRAS-like suppressor 3, HREV107-1, HREV107-3, Renal carcinoma antigen NY-REN-65) (MaxLight 550)
MBS6308338-02 5x 0.1 mL

HRASLS3, CT (PLA2G16, HRASLS3, HREV107, Group XVI phospholipase A1/A2, Adipose-specific phospholipase A2, H-rev 107 protein homolog, HRAS-like suppressor 1, HRAS-like suppressor 3, HREV107-1, HREV107-3, Renal carcinoma antigen NY-REN-65) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Polyclonal CBX1 Antibody [DyLight 350]
NBP2-98756UV 0.1 mL

Rabbit Polyclonal CBX1 Antibody [DyLight 350]

Sign In for Pricing
View Details