Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein theta (YWHAQ)

Recombinant Human 14-3-3 protein theta (YWHAQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: YWHAQ. Target Synonyms: 14-3-3 protein T-cell14-3-3 protein tauProtein HS1. Accession Number: P27348. Expression Region: 1~245aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 54.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human 14-3-3 protein theta (YWHAQ) is a purified Recombinant Protein.

Accession Number

P27348

Expression Region

1~245aa

Host

E. coli

Target

YWHAQ

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

54.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

14-3-3 protein T-cell14-3-3 protein tauProtein HS1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZXDA AAV siRNA Pooled Vector
51995161 1.0 µg

ZXDA AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lentiviral human COPA shRNA (UAS) - Lentiviral human COPA shRNA (UAS, iRFP) plasmid
GTR15343723 1 Vial

Lentiviral human COPA shRNA (UAS) - Lentiviral human COPA shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Flacc1 Mouse siRNA Oligo Duplex (Locus ID 108812)
SR412913 1 Kit

Flacc1 Mouse siRNA Oligo Duplex (Locus ID 108812)

Sign In for Pricing
View Details
Slc38a5 ORF Vector (Mouse) (pORF)
ORF057697 1.0 µg DNA

Slc38a5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Polyclonal DNAJC5B Antibody
H00085479-B01P 0.05 mg

Mouse Polyclonal DNAJC5B Antibody

Sign In for Pricing
View Details
Human TTC8 knockdown cell line
ABC-KD16298 1 Vial

Human TTC8 knockdown cell line

Sign In for Pricing
View Details