Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein theta (YWHAQ)

Recombinant Human 14-3-3 protein theta (YWHAQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: YWHAQ. Target Synonyms: 14-3-3 protein T-cell14-3-3 protein tauProtein HS1. Accession Number: P27348. Expression Region: 1~245aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 54.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human 14-3-3 protein theta (YWHAQ) is a purified Recombinant Protein.

Accession Number

P27348

Expression Region

1~245aa

Host

E. coli

Target

YWHAQ

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

54.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

14-3-3 protein T-cell14-3-3 protein tauProtein HS1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MANSC1 Recombinant Protein (Rat)
RP210665 100 µg

MANSC1 Recombinant Protein (Rat)

Sign In for Pricing
View Details
SulA (HRP)
578147-01 50 µg

SulA (HRP)

Sign In for Pricing
View Details
SulA (HRP)
578147-02 100 µg

SulA (HRP)

Sign In for Pricing
View Details
SMG8 siRNA (Human)
CRJ0534-01 15 nmol

SMG8 siRNA (Human)

Sign In for Pricing
View Details
SMG8 siRNA (Human)
CRJ0534-02 30 nmol

SMG8 siRNA (Human)

Sign In for Pricing
View Details
GPR164 (Olfactory Receptor 51E1, D-GPCR, G-protein Coupled Receptor 164, Olfactory Receptor 52A3, Prostate-overexpressed G-Protein-coupled Receptor, Prostate-specific G-Protein-coupled Receptor 2, OR51E1, OR51E1P, OR52A3P, POGR, PSGR2) discontinued
G8603-29 50 µL

GPR164 (Olfactory Receptor 51E1, D-GPCR, G-protein Coupled Receptor 164, Olfactory Receptor 52A3, Prostate-overexpressed G-Protein-coupled Receptor, Prostate-specific G-Protein-coupled Receptor 2, OR51E1, OR51E1P, OR52A3P, POGR, PSGR2) discontinued

Sign In for Pricing
View Details