Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 14-3-3 protein theta (YWHAQ)

Recombinant Human 14-3-3 protein theta (YWHAQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: YWHAQ. Target Synonyms: 14-3-3 protein T-cell14-3-3 protein tauProtein HS1. Accession Number: P27348. Expression Region: 1~245aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 54.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human 14-3-3 protein theta (YWHAQ) is a purified Recombinant Protein.

Accession Number

P27348

Expression Region

1~245aa

Host

E. coli

Target

YWHAQ

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

54.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

14-3-3 protein T-cell14-3-3 protein tauProtein HS1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-XRCC6BP1/KUB3 Rabbit pAb
GB113036-100 100 μL

Anti-XRCC6BP1/KUB3 Rabbit pAb

Sign In for Pricing
View Details
Rat Discoidin, CUB and LCCL domain-containing protein 2, DCBLD2 ELISA Kit
MBS9326375-01 48 Well

Rat Discoidin, CUB and LCCL domain-containing protein 2, DCBLD2 ELISA Kit

Sign In for Pricing
View Details
Rat Discoidin, CUB and LCCL domain-containing protein 2, DCBLD2 ELISA Kit
MBS9326375-02 96 Well

Rat Discoidin, CUB and LCCL domain-containing protein 2, DCBLD2 ELISA Kit

Sign In for Pricing
View Details
Rat Discoidin, CUB and LCCL domain-containing protein 2, DCBLD2 ELISA Kit
MBS9326375-03 5x 96 Well

Rat Discoidin, CUB and LCCL domain-containing protein 2, DCBLD2 ELISA Kit

Sign In for Pricing
View Details
Rat Discoidin, CUB and LCCL domain-containing protein 2, DCBLD2 ELISA Kit
MBS9326375-04 10x 96 Well

Rat Discoidin, CUB and LCCL domain-containing protein 2, DCBLD2 ELISA Kit

Sign In for Pricing
View Details
Ibutamoren mesylate
MBS3602288-01 5 mg

Ibutamoren mesylate

Sign In for Pricing
View Details