Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Wnt-7b (WNT7B)

Recombinant Human Protein Wnt-7b (WNT7B) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: WNT7B. Target Synonyms: Protein Wnt-7b; Wingless related MMTV integration site 7B; Wingless type MMTV integration site family member 7B; WNT; WNT7B; WNT7B_HUMAN. Accession Number: P56706. Expression Region: 25~349aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 56.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein Wnt-7b (WNT7B) is a purified Recombinant Protein.

Accession Number

P56706

Expression Region

25~349aa

Host

E. coli

Target

WNT7B

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Stem Cells

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

56.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Protein Wnt-7b; Wingless related MMTV integration site 7B; Wingless type MMTV integration site family member 7B; WNT; WNT7B; WNT7B_HUMAN

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Methyl-3-oxo-2,3-dihydro-1 H -isoindole-4-carboxylic acid
PAA26220-01 100 mg

2-Methyl-3-oxo-2,3-dihydro-1 H -isoindole-4-carboxylic acid

Sign In for Pricing
View Details
2-Methyl-3-oxo-2,3-dihydro-1 H -isoindole-4-carboxylic acid
PAA26220-02 1 g

2-Methyl-3-oxo-2,3-dihydro-1 H -isoindole-4-carboxylic acid

Sign In for Pricing
View Details
ARPC4-TTLL3 sgRNA CRISPR Lentivector set (Human)
K2748501 3x 1.0 µg

ARPC4-TTLL3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
P16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: LBI1F5]
AMM16828VCF 100 µg

P16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: LBI1F5]

Sign In for Pricing
View Details
Guinea pig Alpha-protein kinase 3 (ALPK3) ELISA Kit
MBS7224261-01 48 Well

Guinea pig Alpha-protein kinase 3 (ALPK3) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Alpha-protein kinase 3 (ALPK3) ELISA Kit
MBS7224261-02 96 Well

Guinea pig Alpha-protein kinase 3 (ALPK3) ELISA Kit

Sign In for Pricing
View Details