Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse von Willebrand factor (Vwf), partial

Recombinant Mouse von Willebrand factor (Vwf), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Vwf. Target Synonyms: von Willebrand antigen II. Accession Number: Q8CIZ8. Expression Region: 1498~1665aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 23.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse von Willebrand factor (Vwf), partial is a purified Recombinant Protein.

Accession Number

Q8CIZ8

Expression Region

1498~1665aa

Host

E. coli

Target

Vwf

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Von Willebrand antigen II

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster NACHT, LRR and PYD Domains-Containing Protein 2 (NLRP2) ELISA Kit
MBS9910325-01 48 Well

Hamster NACHT, LRR and PYD Domains-Containing Protein 2 (NLRP2) ELISA Kit

Sign In for Pricing
View Details
Hamster NACHT, LRR and PYD Domains-Containing Protein 2 (NLRP2) ELISA Kit
MBS9910325-02 96 Well

Hamster NACHT, LRR and PYD Domains-Containing Protein 2 (NLRP2) ELISA Kit

Sign In for Pricing
View Details
Hamster NACHT, LRR and PYD Domains-Containing Protein 2 (NLRP2) ELISA Kit
MBS9910325-03 5x 96 Well

Hamster NACHT, LRR and PYD Domains-Containing Protein 2 (NLRP2) ELISA Kit

Sign In for Pricing
View Details
Hamster NACHT, LRR and PYD Domains-Containing Protein 2 (NLRP2) ELISA Kit
MBS9910325-04 10x 96 Well

Hamster NACHT, LRR and PYD Domains-Containing Protein 2 (NLRP2) ELISA Kit

Sign In for Pricing
View Details
CCKAR Protein Vector (Rat) (pPM-C-HA)
PV258160 500 ng

CCKAR Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Probable 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA)
MBS1126600 Inquire

Recombinant Probable 1,4-dihydroxy-2-naphthoate octaprenyltransferase (menA)

Sign In for Pricing
View Details