Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin iota chain (VPREB1)

Recombinant Human Immunoglobulin iota chain (VPREB1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: VPREB1. Target Synonyms: CD179 antigen-like family member AProtein VPreB1V (pre) B proteinVpreB proteinCD_antigen: CD179a. Accession Number: P12018. Expression Region: 20~145aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Immunoglobulin iota chain (VPREB1) is a purified Recombinant Protein.

Accession Number

P12018

Expression Region

20~145aa

Host

E. coli

Target

VPREB1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CD179 antigen-like family member AProtein VPreB1V (pre) B proteinVpreB proteinCD_antigen: CD179a

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lmx1a antibody - middle region
MBS3203586-01 0.1 mL

Lmx1a antibody - middle region

Sign In for Pricing
View Details
Lmx1a antibody - middle region
MBS3203586-02 5x 0.1 mL

Lmx1a antibody - middle region

Sign In for Pricing
View Details
Rat Sumf2 Pre-designed siRNA Set A
SI213997A 1 Each

Rat Sumf2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human PSME3 (NM_005789) AAV Particle
RC200308A1V 250 µL

Human PSME3 (NM_005789) AAV Particle

Sign In for Pricing
View Details
GAS7 Antibody
C43865-01 50 μL

GAS7 Antibody

Sign In for Pricing
View Details
GAS7 Antibody
C43865-02 100 µL

GAS7 Antibody

Sign In for Pricing
View Details