Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial brown fat uncoupling protein 1 (UCP1)

Recombinant Human Mitochondrial brown fat uncoupling protein 1 (UCP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: UCP1. Target Synonyms: Solute carrier family 25 member 7Thermogenin. Accession Number: P25874. Expression Region: 2~307aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 48.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Mitochondrial brown fat uncoupling protein 1 (UCP1) is a purified Recombinant Protein.

Accession Number

P25874

Expression Region

2~307aa

Host

E. coli

Target

UCP1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Transport

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

48.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Solute carrier family 25 member 7Thermogenin

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

GGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-beta Actin (Tyr53) Polyclonal Antibody
bs-12581R-01 20 µL

Phospho-beta Actin (Tyr53) Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-beta Actin (Tyr53) Polyclonal Antibody
bs-12581R-02 100 µL

Phospho-beta Actin (Tyr53) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant JEV NS2A (aa 1207–1373) [His] Protein
VAng-Wyb3455-500gEcoli 500 µg (E. coli)

Recombinant JEV NS2A (aa 1207–1373) [His] Protein

Sign In for Pricing
View Details
Cotton Rat CD4 MAb (Clone 695542)
MAB6676-SP 25 µg

Cotton Rat CD4 MAb (Clone 695542)

Sign In for Pricing
View Details
Frmd5 (BC057549) Mouse Tagged Lenti ORF Clone
MR206885L3 10 µg

Frmd5 (BC057549) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human KIT siRNA
abx921686-01 15 nmol

Human KIT siRNA

Sign In for Pricing
View Details