Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2)

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: UBE2V2. Target Synonyms: DDVit 1Enterocyte differentiation-associated factor 1; EDAF-1Enterocyte differentiation-promoting factor 1; EDPF-1MMS2 homologVitamin D3-inducible protein. Accession Number: Q15819. Expression Region: 2~145aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) is a purified Recombinant Protein.

Accession Number

Q15819

Expression Region

2~145aa

Host

E. coli

Target

UBE2V2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DDVit 1Enterocyte differentiation-associated factor 1; EDAF-1Enterocyte differentiation-promoting factor 1; EDPF-1MMS2 homologVitamin D3-inducible protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parathyroid Hormone (PTH, hPTH, Parathormone, Parathyrin) (FITC)
P3109-09F-FITC 100 µL

Parathyroid Hormone (PTH, hPTH, Parathormone, Parathyrin) (FITC)

Sign In for Pricing
View Details
CHPT1 3'UTR GFP Stable Cell Line
TU054377 1.0 mL

CHPT1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SLC6A15 Protein Vector (Rat) (pPB-N-His)
PV306331 500 ng

SLC6A15 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
KLK-BL4 antibody
MBS5301533-01 0.1 mL

KLK-BL4 antibody

Sign In for Pricing
View Details
KLK-BL4 antibody
MBS5301533-02 5x 0.1 mL

KLK-BL4 antibody

Sign In for Pricing
View Details
Zebrafish DLC (C-Term) Rabbit pAb
MBS8557521-01 0.1 mL

Zebrafish DLC (C-Term) Rabbit pAb

Sign In for Pricing
View Details