Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2)

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: UBE2V2. Target Synonyms: DDVit 1Enterocyte differentiation-associated factor 1; EDAF-1Enterocyte differentiation-promoting factor 1; EDPF-1MMS2 homologVitamin D3-inducible protein. Accession Number: Q15819. Expression Region: 2~145aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2 (UBE2V2) is a purified Recombinant Protein.

Accession Number

Q15819

Expression Region

2~145aa

Host

E. coli

Target

UBE2V2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

DDVit 1Enterocyte differentiation-associated factor 1; EDAF-1Enterocyte differentiation-promoting factor 1; EDPF-1MMS2 homologVitamin D3-inducible protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PTEN (T401) Antibody [APR09207G]
APR09207G-01 50 µL

Phospho-PTEN (T401) Antibody [APR09207G]

Sign In for Pricing
View Details
Phospho-PTEN (T401) Antibody [APR09207G]
APR09207G-02 100 µL

Phospho-PTEN (T401) Antibody [APR09207G]

Sign In for Pricing
View Details
Phospho-PTEN (T401) Antibody [APR09207G]
APR09207G-03 200 µL

Phospho-PTEN (T401) Antibody [APR09207G]

Sign In for Pricing
View Details
Phospho-PTEN (T401) Antibody [APR09207G]
APR09207G-04 400 µL

Phospho-PTEN (T401) Antibody [APR09207G]

Sign In for Pricing
View Details
STARD8 Polyclonal Antibody, APC Conjugated
bs-6159R-APC 100 µL

STARD8 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Recombinant Nicotiana tabacum Endochitinase A/CHN48 Protein, N-His
PR003012-01 50 µg

Recombinant Nicotiana tabacum Endochitinase A/CHN48 Protein, N-His

Sign In for Pricing
View Details