Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding protein RO60 (RO60), partial

Recombinant Human RNA-binding protein RO60 (RO60), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RO60. Target Synonyms: Ro 60 kDa autoantigen; Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen; SS-ATROVE domain family member 2. Accession Number: P10155. Expression Region: 3~535aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 64.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RNA-binding protein RO60 (RO60), partial is a purified Recombinant Protein.

Accession Number

P10155

Expression Region

3~535aa

Host

E. coli

Target

RO60

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ro 60 kDa autoantigen; Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen; SS-ATROVE domain family member 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Frizzled 10 Antibody
MBS8306713-01 0.03 mL

Anti-Frizzled 10 Antibody

Sign In for Pricing
View Details
Anti-Frizzled 10 Antibody
MBS8306713-02 0.05 mL

Anti-Frizzled 10 Antibody

Sign In for Pricing
View Details
Anti-Frizzled 10 Antibody
MBS8306713-03 0.1 mL

Anti-Frizzled 10 Antibody

Sign In for Pricing
View Details
Anti-Frizzled 10 Antibody
MBS8306713-04 0.2 mL

Anti-Frizzled 10 Antibody

Sign In for Pricing
View Details
Anti-Frizzled 10 Antibody
MBS8306713-05 5x 0.2 mL

Anti-Frizzled 10 Antibody

Sign In for Pricing
View Details
NDUFAF1 Antibody
KC-1273-01 50 μL

NDUFAF1 Antibody

Sign In for Pricing
View Details