Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding protein RO60 (RO60), partial

Recombinant Human RNA-binding protein RO60 (RO60), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RO60. Target Synonyms: Ro 60 kDa autoantigen; Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen; SS-ATROVE domain family member 2. Accession Number: P10155. Expression Region: 3~535aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 64.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RNA-binding protein RO60 (RO60), partial is a purified Recombinant Protein.

Accession Number

P10155

Expression Region

3~535aa

Host

E. coli

Target

RO60

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ro 60 kDa autoantigen; Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen; SS-ATROVE domain family member 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-amino-4-sulfobutanoic acid
HY-W016342 1 g

2-amino-4-sulfobutanoic acid

Sign In for Pricing
View Details
RBMXL2 Rabbit mAb
MBS9471061-01 0.05 mL

RBMXL2 Rabbit mAb

Sign In for Pricing
View Details
RBMXL2 Rabbit mAb
MBS9471061-02 0.1 mL

RBMXL2 Rabbit mAb

Sign In for Pricing
View Details
RBMXL2 Rabbit mAb
MBS9471061-03 5x 0.1 mL

RBMXL2 Rabbit mAb

Sign In for Pricing
View Details
ATP5B Antibody
orb1257339 100 µL

ATP5B Antibody

Sign In for Pricing
View Details
Mouse Proliferation Marker, clone IPO-38 (Monoclonal) Antibody
orb557177 100 µg

Mouse Proliferation Marker, clone IPO-38 (Monoclonal) Antibody

Sign In for Pricing
View Details