Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RNA-binding protein RO60 (RO60), partial

Recombinant Human RNA-binding protein RO60 (RO60), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RO60. Target Synonyms: Ro 60 kDa autoantigen; Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen; SS-ATROVE domain family member 2. Accession Number: P10155. Expression Region: 3~535aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 64.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human RNA-binding protein RO60 (RO60), partial is a purified Recombinant Protein.

Accession Number

P10155

Expression Region

3~535aa

Host

E. coli

Target

RO60

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ro 60 kDa autoantigen; Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen; SS-ATROVE domain family member 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 Rabbit Monoclonal Antibody
E49Y5826 100 µL

SOX10 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CORO6 (NM_032854) Human Recombinant Protein
PH34703M5 20 µg

CORO6 (NM_032854) Human Recombinant Protein

Sign In for Pricing
View Details
Human ATP synthase subunit s like protein (ATP5SL) ELISA Kit
MBS7221242-01 48 Well

Human ATP synthase subunit s like protein (ATP5SL) ELISA Kit

Sign In for Pricing
View Details
Human ATP synthase subunit s like protein (ATP5SL) ELISA Kit
MBS7221242-02 96 Well

Human ATP synthase subunit s like protein (ATP5SL) ELISA Kit

Sign In for Pricing
View Details
Human ATP synthase subunit s like protein (ATP5SL) ELISA Kit
MBS7221242-03 5x 96 Well

Human ATP synthase subunit s like protein (ATP5SL) ELISA Kit

Sign In for Pricing
View Details
Human ATP synthase subunit s like protein (ATP5SL) ELISA Kit
MBS7221242-04 10x 96 Well

Human ATP synthase subunit s like protein (ATP5SL) ELISA Kit

Sign In for Pricing
View Details