Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TREM2. Target Synonyms: Triggering receptor expressed on monocytes 2. Accession Number: Q9NZC2. Expression Region: 19~174aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial is a purified Recombinant Protein.

Accession Number

Q9NZC2

Expression Region

19~174aa

Host

E. coli

Target

TREM2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Extracellular Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Triggering receptor expressed on monocytes 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse pre-microRNA Expression Construct mir-370
MMIR-370-PA-1 Bacterial Streak

Mouse pre-microRNA Expression Construct mir-370

Sign In for Pricing
View Details
Metzenbaum Scissors Lahey Curved
0313-4 5.75 Inches

Metzenbaum Scissors Lahey Curved

Sign In for Pricing
View Details
Phospho-RAD9 (Tyr28) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5659R-BF647 100 µL

Phospho-RAD9 (Tyr28) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
NRG1 (NM_004495) Human Tagged Lenti ORF Clone
RC220353L4 10 µg

NRG1 (NM_004495) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human C3 ELISA Kit
E-80C3 1 Plate

Human C3 ELISA Kit

Sign In for Pricing
View Details
CYTSA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0558108 1.0 µg DNA

CYTSA sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details