Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Tryptase (Tpsab1)

Recombinant Rat Tryptase (Tpsab1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Tpsab1. Target Synonyms: Mast cell protease 7. Accession Number: P27435. Expression Region: 29~273aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 47.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Tryptase (Tpsab1) is a purified Recombinant Protein.

Accession Number

P27435

Expression Region

29~273aa

Host

E. coli

Target

Tpsab1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mast cell protease 7

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIYRYVPKYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1684 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
34136156 3x 1.0 µg DNA

Olr1684 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Serpinb9f CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
43495154 3x 1.0 µg DNA

Serpinb9f CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r60 shRNA (UAS) - Lentiviral mouseVmn1r60 shRNA (UAS, GFP) (25)
GTR15109400 1 Vial

Lentiviral mouse Vmn1r60 shRNA (UAS) - Lentiviral mouseVmn1r60 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
O-Toluidine-4-sulfonic Acid Sodium Salt Tetrahydrate
sc-475179 25 g

O-Toluidine-4-sulfonic Acid Sodium Salt Tetrahydrate

Sign In for Pricing
View Details
EIF2C2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
19090061 1.0 µg DNA

EIF2C2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
LOC100362453 Antibody - C-terminal region : HRP (ARP56187_P050-HRP)
ARP56187_P050-HRP 100 µL

LOC100362453 Antibody - C-terminal region : HRP (ARP56187_P050-HRP)

Sign In for Pricing
View Details