Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Tryptase (Tpsab1)

Recombinant Rat Tryptase (Tpsab1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Tpsab1. Target Synonyms: Mast cell protease 7. Accession Number: P27435. Expression Region: 29~273aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 47.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Tryptase (Tpsab1) is a purified Recombinant Protein.

Accession Number

P27435

Expression Region

29~273aa

Host

E. coli

Target

Tpsab1

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

47.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mast cell protease 7

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIYRYVPKYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Benzylaminopurine (BA) Solution
B2022795 100 mL

6-Benzylaminopurine (BA) Solution

Sign In for Pricing
View Details
CCL26 Rabbit Polyclonal Antibody (APC-Cy7)
orb1605395 100 µL

CCL26 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
hsa-miR-4653-5p miRNA Antagomir
MNH02487 2x 5.0 nmol

hsa-miR-4653-5p miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Burkholderia vietnamiensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)
MBS7021862-01 0.02 mg

Recombinant Burkholderia vietnamiensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Sign In for Pricing
View Details
Recombinant Burkholderia vietnamiensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)
MBS7021862-02 0.1 mg

Recombinant Burkholderia vietnamiensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Sign In for Pricing
View Details
Recombinant Burkholderia vietnamiensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)
MBS7021862-03 5x 0.1 mg

Recombinant Burkholderia vietnamiensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Sign In for Pricing
View Details