Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI)

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus) . Target Name: TFPI. Target Synonyms: Extrinsic pathway inhibitor; EPILipoprotein-associated coagulation inhibitor; LACI. Accession Number: P19761. Expression Region: 25~300aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 35.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) is a purified Recombinant Protein.

Accession Number

P19761

Expression Region

25~300aa

Host

E. coli

Target

TFPI

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Extrinsic pathway inhibitor; EPILipoprotein-associated coagulation inhibitor; LACI

Species

Rabbit (Oryctolagus cuniculus)

Protein Name

Recombinant Protein

AA Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)
MBS1308180-01 0.02 mg (E-Coli)

Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)
MBS1308180-02 0.1 mg (E-Coli)

Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)
MBS1308180-03 0.02 mg (Yeast)

Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)
MBS1308180-04 0.1 mg (Yeast)

Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)
MBS1308180-05 0.02 mg (Baculovirus)

Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)

Sign In for Pricing
View Details
Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)
MBS1308180-06 0.02 mg (Mammalian-Cell)

Recombinant Shigella boydii serotype 4 (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase (fabZ)

Sign In for Pricing
View Details