Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trefoil factor 1 (TFF1)

Recombinant Human Trefoil factor 1 (TFF1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TFF1. Target Synonyms: Breast cancer estrogen-inducible protein; PNR-2; Polypeptide P1.A; hP1.AProtein pS2. Accession Number: P04155. Expression Region: 25~84aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 33.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Trefoil factor 1 (TFF1) is a purified Recombinant Protein.

Accession Number

P04155

Expression Region

25~84aa

Host

E. coli

Target

TFF1

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Breast cancer estrogen-inducible protein; PNR-2; Polypeptide P1.A; hP1.AProtein pS2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA11I Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV726000 1.0 µg DNA

FRA11I Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Semaphorin 4B (Semaphorin-4B, SEMA4B, KIAA1745, SEMAC, SemC, UNQ749/PRO1480) (PE)
MBS6160174-01 0.1 mL

Semaphorin 4B (Semaphorin-4B, SEMA4B, KIAA1745, SEMAC, SemC, UNQ749/PRO1480) (PE)

Sign In for Pricing
View Details
Semaphorin 4B (Semaphorin-4B, SEMA4B, KIAA1745, SEMAC, SemC, UNQ749/PRO1480) (PE)
MBS6160174-02 5x 0.1 mL

Semaphorin 4B (Semaphorin-4B, SEMA4B, KIAA1745, SEMAC, SemC, UNQ749/PRO1480) (PE)

Sign In for Pricing
View Details
Aqp5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
12223116 3x 1.0 µg

Aqp5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
PerCP-Cy5.5 anti-mouse IgD
E16SDQ501-025U 25 µg

PerCP-Cy5.5 anti-mouse IgD

Sign In for Pricing
View Details
KCNQ1 (NM_000218) Human Over-expression Lysate
LS003784 100 µg

KCNQ1 (NM_000218) Human Over-expression Lysate

Sign In for Pricing
View Details