Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L)

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TAF5L. Target Synonyms: PCAF-associated factor 65 beta. Accession Number: O75529. Expression Region: 1~325aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 64kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L) is a purified Recombinant Protein.

Accession Number

O75529

Expression Region

1~325aa

Host

E. coli

Target

TAF5L

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform 2

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PCAF-associated factor 65 beta

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MED31 Antibody
MBS8200280-01 0.03 mL

Anti-MED31 Antibody

Sign In for Pricing
View Details
Anti-MED31 Antibody
MBS8200280-02 0.05 mL

Anti-MED31 Antibody

Sign In for Pricing
View Details
Anti-MED31 Antibody
MBS8200280-03 0.1 mL

Anti-MED31 Antibody

Sign In for Pricing
View Details
Anti-MED31 Antibody
MBS8200280-04 0.2 mL

Anti-MED31 Antibody

Sign In for Pricing
View Details
Anti-MED31 Antibody
MBS8200280-05 5x 0.2 mL

Anti-MED31 Antibody

Sign In for Pricing
View Details
SLC25A37 Polyclonal Antibody
ANT-14424-100ug 100 µg

SLC25A37 Polyclonal Antibody

Sign In for Pricing
View Details