Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L)

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TAF5L. Target Synonyms: PCAF-associated factor 65 beta. Accession Number: O75529. Expression Region: 1~325aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 64kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L) is a purified Recombinant Protein.

Accession Number

O75529

Expression Region

1~325aa

Host

E. coli

Target

TAF5L

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform 2

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PCAF-associated factor 65 beta

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akr7a5 (BC031857) Mouse Tagged ORF Clone
MR205038 10 µg

Akr7a5 (BC031857) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) rplU Polyclonal Antibody
MBS7145765 Inquire

Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) rplU Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Langya virus/LayV V Protein, N-His
YVV18701 100 μg

Recombinant Langya virus/LayV V Protein, N-His

Sign In for Pricing
View Details
Mouse Monoclonal His Tag Antibody (AD1.1.10) [PE/Cy5.5]
FAB050PECY55 0.1 mL

Mouse Monoclonal His Tag Antibody (AD1.1.10) [PE/Cy5.5]

Sign In for Pricing
View Details
ICI 169369
HY-106805-01 1 mg

ICI 169369

Sign In for Pricing
View Details
ICI 169369
HY-106805-02 5 mg

ICI 169369

Sign In for Pricing
View Details