Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L)

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: TAF5L. Target Synonyms: PCAF-associated factor 65 beta. Accession Number: O75529. Expression Region: 1~325aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 64kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L) is a purified Recombinant Protein.

Accession Number

O75529

Expression Region

1~325aa

Host

E. coli

Target

TAF5L

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform 2

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

64kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PCAF-associated factor 65 beta

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM30A Human shRNA Lentiviral Particle (Locus ID 29064)
TL317129V 500 µL Each

FAM30A Human shRNA Lentiviral Particle (Locus ID 29064)

Sign In for Pricing
View Details
Human NSL1 Knockout A549 cell line
GTR15406917 1 Vial

Human NSL1 Knockout A549 cell line

Sign In for Pricing
View Details
Anti-GluR-delta antibody
STJ93292 200 µl

Anti-GluR-delta antibody

Sign In for Pricing
View Details
EIF2B3 antibody
MBS830666-01 0.1 mL

EIF2B3 antibody

Sign In for Pricing
View Details
EIF2B3 antibody
MBS830666-02 5x 0.1 mL

EIF2B3 antibody

Sign In for Pricing
View Details
Anti-IL17F Picoband Antibody
MBS1750740-01 0.01 mg

Anti-IL17F Picoband Antibody

Sign In for Pricing
View Details