Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Sortilin (Sort1), partial

Recombinant Rat Sortilin (Sort1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Sort1. Target Synonyms: Glycoprotein 110; Gp110Neurotensin receptor 3; NTR3. Accession Number: O54861. Expression Region: 610~754aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 20.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Sortilin (Sort1), partial is a purified Recombinant Protein.

Accession Number

O54861

Expression Region

610~754aa

Host

E. coli

Target

Sort1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

20.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Glycoprotein 110; Gp110Neurotensin receptor 3; NTR3

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFIB (Nuclear Factor 1 B-type, CCAAT-box-binding Transcription Factor, Nuclear Factor I/B, TGGCA-binding Protein, NF1-B, Nuclear Factor 1/B, CTF, NF-I/B, NFI-B) (MaxLight 550)
130334-ML550 100 µL

NFIB (Nuclear Factor 1 B-type, CCAAT-box-binding Transcription Factor, Nuclear Factor I/B, TGGCA-binding Protein, NF1-B, Nuclear Factor 1/B, CTF, NF-I/B, NFI-B) (MaxLight 550)

Sign In for Pricing
View Details
Human ITGAIIb&ITGB3 Heterodimer Protein (Leu 32-Arg 993 (ITGAIIb)&Gly 27-Asp 718 (ITGB3))
VAng-1850Lsx-1mg 1 mg

Human ITGAIIb&ITGB3 Heterodimer Protein (Leu 32-Arg 993 (ITGAIIb)&Gly 27-Asp 718 (ITGB3))

Sign In for Pricing
View Details
Ly96 3'UTR Lenti-reporter-Luc Vector
27829086 1.0 µg

Ly96 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TSNAX Antibody
MBS7114430-01 0.05 mg

TSNAX Antibody

Sign In for Pricing
View Details
TSNAX Antibody
MBS7114430-02 0.1 mg

TSNAX Antibody

Sign In for Pricing
View Details
TSNAX Antibody
MBS7114430-03 5x 0.1 mg

TSNAX Antibody

Sign In for Pricing
View Details