Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Alpha-synuclein (SNCA)

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: SNCA. Target Synonyms: SNCA; Alpha-synuclein. Accession Number: P61142. Expression Region: 1~140aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) is a purified Recombinant Protein.

Accession Number

P61142

Expression Region

1~140aa

Host

E. coli

Target

SNCA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SNCA; Alpha-synuclein

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Recombinant Protein

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quick Step Mouse Interleukin 5, IL-5 ELISA KIT
QS0324Mo-01 48 Tests

Quick Step Mouse Interleukin 5, IL-5 ELISA KIT

Sign In for Pricing
View Details
Quick Step Mouse Interleukin 5, IL-5 ELISA KIT
QS0324Mo-02 96 Tests

Quick Step Mouse Interleukin 5, IL-5 ELISA KIT

Sign In for Pricing
View Details
Mouse Monoclonal IL-23 R Antibody (15N6C6) [DyLight 350]
NBP2-27092UV 0.1 mL

Mouse Monoclonal IL-23 R Antibody (15N6C6) [DyLight 350]

Sign In for Pricing
View Details
KANK1 Antibody, HRP Conjugated
MBS7113891-01 0.05 mg

KANK1 Antibody, HRP Conjugated

Sign In for Pricing
View Details
KANK1 Antibody, HRP Conjugated
MBS7113891-02 0.1 mg

KANK1 Antibody, HRP Conjugated

Sign In for Pricing
View Details
KANK1 Antibody, HRP Conjugated
MBS7113891-03 5x 0.1 mg

KANK1 Antibody, HRP Conjugated

Sign In for Pricing
View Details