Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Alpha-synuclein (SNCA)

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: SNCA. Target Synonyms: SNCA; Alpha-synuclein. Accession Number: P61142. Expression Region: 1~140aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) is a purified Recombinant Protein.

Accession Number

P61142

Expression Region

1~140aa

Host

E. coli

Target

SNCA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SNCA; Alpha-synuclein

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Recombinant Protein

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tprgl sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
47394114 3x 1.0 µg

Tprgl sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PECFP-C1-TLR4-m (6Synonymous mutation)
BZ20317 1 Vial

PECFP-C1-TLR4-m (6Synonymous mutation)

Sign In for Pricing
View Details
SETMAR Antibody
E315062 100 µg - 200 µL

SETMAR Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SART1 Antibody [DyLight 550]
NBP2-14836R 0.1 mL

Rabbit Polyclonal SART1 Antibody [DyLight 550]

Sign In for Pricing
View Details
MCM2 (DNA Replication Licensing Factor MCM2, Minichromosome Maintenance Protein 2 Homolog, Nuclear Protein BM28, BM28, CCNL1, CDCL1, KIAA0030, MGC10606) (MaxLight 650)
MBS6223142-01 0.1 mL

MCM2 (DNA Replication Licensing Factor MCM2, Minichromosome Maintenance Protein 2 Homolog, Nuclear Protein BM28, BM28, CCNL1, CDCL1, KIAA0030, MGC10606) (MaxLight 650)

Sign In for Pricing
View Details
MCM2 (DNA Replication Licensing Factor MCM2, Minichromosome Maintenance Protein 2 Homolog, Nuclear Protein BM28, BM28, CCNL1, CDCL1, KIAA0030, MGC10606) (MaxLight 650)
MBS6223142-02 5x 0.1 mL

MCM2 (DNA Replication Licensing Factor MCM2, Minichromosome Maintenance Protein 2 Homolog, Nuclear Protein BM28, BM28, CCNL1, CDCL1, KIAA0030, MGC10606) (MaxLight 650)

Sign In for Pricing
View Details