Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Alpha-synuclein (SNCA)

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) . Target Name: SNCA. Target Synonyms: SNCA; Alpha-synuclein. Accession Number: P61142. Expression Region: 1~140aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) is a purified Recombinant Protein.

Accession Number

P61142

Expression Region

1~140aa

Host

E. coli

Target

SNCA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

30.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SNCA; Alpha-synuclein

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Protein Name

Recombinant Protein

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr873 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
33508124 3x 1.0µg DNA

Olfr873 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Human NUMA1 / Nuclear mitotic apparatus protein 1 ELISA Kit
MBS2905499-01 48 Well

Human NUMA1 / Nuclear mitotic apparatus protein 1 ELISA Kit

Sign In for Pricing
View Details
Human NUMA1 / Nuclear mitotic apparatus protein 1 ELISA Kit
MBS2905499-02 96 Well

Human NUMA1 / Nuclear mitotic apparatus protein 1 ELISA Kit

Sign In for Pricing
View Details
Human NUMA1 / Nuclear mitotic apparatus protein 1 ELISA Kit
MBS2905499-03 5x 96 Well

Human NUMA1 / Nuclear mitotic apparatus protein 1 ELISA Kit

Sign In for Pricing
View Details
Human NUMA1 / Nuclear mitotic apparatus protein 1 ELISA Kit
MBS2905499-04 10x 96 Well

Human NUMA1 / Nuclear mitotic apparatus protein 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Angiotensin 3 ELISA Kit
MBS739806-01 48 Well

Sheep Angiotensin 3 ELISA Kit

Sign In for Pricing
View Details