Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Non-specific lipid-transfer protein (SCP2)

Recombinant Human Non-specific lipid-transfer protein (SCP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: SCP2. Target Synonyms: Propanoyl-CoA C-acyltransferase; SCP-chiSCPXSterol carrier protein 2; SCP-2Sterol carrier protein X; SCP-X. Accession Number: P22307. Expression Region: 1~143aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 42.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Non-specific lipid-transfer protein (SCP2) is a purified Recombinant Protein.

Accession Number

P22307

Expression Region

1~143aa

Host

E. coli

Target

SCP2

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Transport

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Isoform SCP2

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Propanoyl-CoA C-acyltransferase; SCP-chiSCPXSterol carrier protein 2; SCP-2Sterol carrier protein X; SCP-X

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)
MBS2074413-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)
MBS2074413-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)
MBS2074413-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)
MBS2074413-04 1 mL

Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)
MBS2074413-05 5 mL

Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)
MBS2074413-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Solute Carrier Family 3, Member 2 (SLC3A2)

Sign In for Pricing
View Details