Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A4 (S100A4)

Recombinant Human Protein S100-A4 (S100A4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: S100A4. Target Synonyms: Calvasculin; Metastasin; Placental calcium-binding protein; Protein Mts1S100 calcium-binding protein A4. Accession Number: P26447. Expression Region: 2~101aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein S100-A4 (S100A4) is a purified Recombinant Protein.

Accession Number

P26447

Expression Region

2~101aa

Host

E. coli

Target

S100A4

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Calvasculin; Metastasin; Placental calcium-binding protein; Protein Mts1S100 calcium-binding protein A4

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

YBR292C Antibody
orb850597 2 mg

YBR292C Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Liver X Receptor Beta (LXRb)
TRV-0042466-01 20 µL

Polyclonal Antibody to Liver X Receptor Beta (LXRb)

Sign In for Pricing
View Details
Polyclonal Antibody to Liver X Receptor Beta (LXRb)
TRV-0042466-02 100 µL

Polyclonal Antibody to Liver X Receptor Beta (LXRb)

Sign In for Pricing
View Details
Polyclonal Antibody to Liver X Receptor Beta (LXRb)
TRV-0042466-03 200 µL

Polyclonal Antibody to Liver X Receptor Beta (LXRb)

Sign In for Pricing
View Details
Polyclonal Antibody to Liver X Receptor Beta (LXRb)
TRV-0042466-04 1 mL

Polyclonal Antibody to Liver X Receptor Beta (LXRb)

Sign In for Pricing
View Details
ACBD5 Peptide
DF9152-BP 1 mg

ACBD5 Peptide

Sign In for Pricing
View Details