Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A12 (S100A12)

Recombinant Human Protein S100-A12 (S100A12) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: S100A12. Target Synonyms: CGRPCalcium-binding protein in amniotic fluid 1. Accession Number: P80511. Expression Region: 2~92aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 37.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Protein S100-A12 (S100A12) is a purified Recombinant Protein.

Accession Number

P80511

Expression Region

2~92aa

Host

E. coli

Target

S100A12

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

37.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CGRPCalcium-binding protein in amniotic fluid 1

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCC3 HDR Plasmid (h)
sc-407685-HDR 20 µg

BRCC3 HDR Plasmid (h)

Sign In for Pricing
View Details
Rabbit Polyclonal TCEAL3 Antibody [mFluor Violet 450 SE]
NBP2-98537MFV450 0.1 mL

Rabbit Polyclonal TCEAL3 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
BUB1 siRNA (h)
sc-37538 10 µM

BUB1 siRNA (h)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Uncharacterized 14.2 kDa protein in e-segB intergenic region (y06N)
MBS1072283-01 0.02 mg (E-Coli)

Recombinant Enterobacteria phage T4 Uncharacterized 14.2 kDa protein in e-segB intergenic region (y06N)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Uncharacterized 14.2 kDa protein in e-segB intergenic region (y06N)
MBS1072283-02 0.1 mg (E-Coli)

Recombinant Enterobacteria phage T4 Uncharacterized 14.2 kDa protein in e-segB intergenic region (y06N)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Uncharacterized 14.2 kDa protein in e-segB intergenic region (y06N)
MBS1072283-03 0.02 mg (Yeast)

Recombinant Enterobacteria phage T4 Uncharacterized 14.2 kDa protein in e-segB intergenic region (y06N)

Sign In for Pricing
View Details