Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein R-Ras2 (RRAS2)

Recombinant Human Ras-related protein R-Ras2 (RRAS2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RRAS2. Target Synonyms: Ras-like protein TC21Teratocarcinoma oncogene. Accession Number: P62070. Expression Region: 1~204aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 50.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Ras-related protein R-Ras2 (RRAS2) is a purified Recombinant Protein.

Accession Number

P62070

Expression Region

1~204aa

Host

E. coli

Target

RRAS2

Conjugation

Unconjugated

Tag

N-Terminal Gst-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

50.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Ras-like protein TC21Teratocarcinoma oncogene

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]
E-AB-F12290-01 100 µg

AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]
E-AB-F12290-02 1 mg

AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]
E-AB-F12290-03 5 mg

AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]
E-AB-F12290-04 25 mg

AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]
E-AB-F12290-05 50 mg

AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]
E-AB-F12290-06 100 mg

AF/LE Purified Anti-Human CD279 Antibody[EH12.2H7]

Sign In for Pricing
View Details