Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Non-secretory ribonuclease (RNASE2)

Recombinant Human Non-secretory ribonuclease (RNASE2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: RNASE2. Target Synonyms: Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2; RNase 2Ribonuclease US. Accession Number: P10153. Expression Region: 28~161aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 19.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Non-secretory ribonuclease (RNASE2) is a purified Recombinant Protein.

Accession Number

P10153

Expression Region

28~161aa

Host

E. coli

Target

RNASE2

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Immunology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2; RNase 2Ribonuclease US

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR0B11, CT (Nuclear Receptor Subfamily 0 Group B Member 1, Nuclear Receptor DAX-1, DSS-AHC Critical Region On The X Chromosome Protein 1, DAX, AHC, DAX1) (Azide free) (HRP)
MBS6490687-01 0.2 mL

NR0B11, CT (Nuclear Receptor Subfamily 0 Group B Member 1, Nuclear Receptor DAX-1, DSS-AHC Critical Region On The X Chromosome Protein 1, DAX, AHC, DAX1) (Azide free) (HRP)

Sign In for Pricing
View Details
NR0B11, CT (Nuclear Receptor Subfamily 0 Group B Member 1, Nuclear Receptor DAX-1, DSS-AHC Critical Region On The X Chromosome Protein 1, DAX, AHC, DAX1) (Azide free) (HRP)
MBS6490687-02 5x 0.2 mL

NR0B11, CT (Nuclear Receptor Subfamily 0 Group B Member 1, Nuclear Receptor DAX-1, DSS-AHC Critical Region On The X Chromosome Protein 1, DAX, AHC, DAX1) (Azide free) (HRP)

Sign In for Pricing
View Details
hsa-miR-7110-3p miRNA Inhibitor
MIH03762 2x 5.0 nmol

hsa-miR-7110-3p miRNA Inhibitor

Sign In for Pricing
View Details
FAM53A (NM_001013622) Human Tagged ORF Clone Lentiviral Particle
RC209892L3V 200 µL

FAM53A (NM_001013622) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Fluoren-3-ol-d9 (Major)
450170 1 mg

Fluoren-3-ol-d9 (Major)

Sign In for Pricing
View Details
Quick Step Human Protein Inhibitor of Activated Stat 4 (PIAS4) ELISA Kit
QS4238Hu-01 48 Tests

Quick Step Human Protein Inhibitor of Activated Stat 4 (PIAS4) ELISA Kit

Sign In for Pricing
View Details