Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PTPRB. Target Synonyms: Vascular endothelial protein tyrosine phosphatase; VE-PTP. Accession Number: P23467. Expression Region: 1643~1997aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 57.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial is a purified Recombinant Protein.

Accession Number

P23467

Expression Region

1643~1997aa

Host

E. coli

Target

PTPRB

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Cytoplasmic Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

57.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Vascular endothelial protein tyrosine phosphatase; VE-PTP

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit
MBS932371-01 24 Well (LIMIT 1)

Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit

Sign In for Pricing
View Details
Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit
MBS932371-02 48 Well

Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit

Sign In for Pricing
View Details
Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit
MBS932371-03 96 Well

Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit

Sign In for Pricing
View Details
Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit
MBS932371-04 5x 96 Well

Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit

Sign In for Pricing
View Details
Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit
MBS932371-05 10x 96 Well

Canine Fibroblast Growth Factor 23, FGF23 ELISA Kit

Sign In for Pricing
View Details
PIAS1 ORF Vector (Human) (pORF)
36632011 1.0 µg DNA

PIAS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details