Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PTPRB. Target Synonyms: Vascular endothelial protein tyrosine phosphatase; VE-PTP. Accession Number: P23467. Expression Region: 1643~1997aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 57.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial is a purified Recombinant Protein.

Accession Number

P23467

Expression Region

1643~1997aa

Host

E. coli

Target

PTPRB

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Cytoplasmic Domain

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

57.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Vascular endothelial protein tyrosine phosphatase; VE-PTP

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFIALDRILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRARKLRSEQENPLFPIYENVNPEYHRDPVYSRH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM4B (Lysine-Specific Demethylase 4B, Lysine Demethylase 4B)
484107 100 µL

KDM4B (Lysine-Specific Demethylase 4B, Lysine Demethylase 4B)

Sign In for Pricing
View Details
3-Aminophenol 99% Extrapure
00164 00250 250 g

3-Aminophenol 99% Extrapure

Sign In for Pricing
View Details
Lentiviral mouse Eps8l2 shRNA (UAS) - Lentiviral mouse Eps8l2 shRNA (UAS, RFP) (100)
GTR15149472 1 Vial

Lentiviral mouse Eps8l2 shRNA (UAS) - Lentiviral mouse Eps8l2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
NGLY1 Antibody - middle region : Biotin (ARP75684_P050-Biotin)
ARP75684_P050-Biotin 100 µL

NGLY1 Antibody - middle region : Biotin (ARP75684_P050-Biotin)

Sign In for Pricing
View Details
FJX1 Antibody
MBS9523515-01 0.04 mL

FJX1 Antibody

Sign In for Pricing
View Details
FJX1 Antibody
MBS9523515-02 0.1 mL

FJX1 Antibody

Sign In for Pricing
View Details