Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Anionic trypsin-1 (Prss1)

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Prss1. Target Synonyms: Anionic trypsin IPretrypsinogen ISerine protease 1. Accession Number: P00762. Expression Region: 24~246aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein.

Accession Number

P00762

Expression Region

24~246aa

Host

E. coli

Target

Prss1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Anionic trypsin IPretrypsinogen ISerine protease 1

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1A7 siRNA (m)
sc-140998 10 µM

ALDH1A7 siRNA (m)

Sign In for Pricing
View Details
Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein
abx168943-01 10 µg

Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein

Sign In for Pricing
View Details
Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein
abx168943-02 50 µg

Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein

Sign In for Pricing
View Details
Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein
abx168943-03 100 µg

Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein

Sign In for Pricing
View Details
Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein
abx168943-04 200 µg

Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein

Sign In for Pricing
View Details
Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein
abx168943-05 500 µg

Human Cytoplasmic Polyadenylation Element Binding Protein 1 (CPEB1) Protein

Sign In for Pricing
View Details