Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Anionic trypsin-1 (Prss1)

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Prss1. Target Synonyms: Anionic trypsin IPretrypsinogen ISerine protease 1. Accession Number: P00762. Expression Region: 24~246aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 39.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein.

Accession Number

P00762

Expression Region

24~246aa

Host

E. coli

Target

Prss1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

39.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Anionic trypsin IPretrypsinogen ISerine protease 1

Species

Rat (Rattus norvegicus)

Protein Name

Recombinant Protein

AA Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ube2d2 (NM_001037292) Rat Tagged ORF Clone Lentiviral Particle
RR214498L4V 200 µL

Ube2d2 (NM_001037292) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-SYNPO2L antibody
STJ114564 100 µl

Anti-SYNPO2L antibody

Sign In for Pricing
View Details
Phospho-CD3 ζ (Tyr 142) Rabbit mAb
C06541-100uL*2 2x 100μL

Phospho-CD3 ζ (Tyr 142) Rabbit mAb

Sign In for Pricing
View Details
DSTYK Antibody - N-terminal region
OAAB21148-200UL 200 µL

DSTYK Antibody - N-terminal region

Sign In for Pricing
View Details
Rnps1 ORF Vector (Mouse) (pORF)
ORF056255 1.0 µg DNA

Rnps1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Monoclonal CD68/SR-D1 Antibody (2449D) [CoraFluor 1]
FAB101141CL1 0.1 mL

Rabbit Monoclonal CD68/SR-D1 Antibody (2449D) [CoraFluor 1]

Sign In for Pricing
View Details