Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-1 (PRDX1)

Recombinant Human Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PRDX1. Target Synonyms: Natural killer cell-enhancing factor AProliferation-associated gene proteinThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2PAGA, PAGB, TDPX2. Accession Number: Q06830. Expression Region: 1~199aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein.

Accession Number

Q06830

Expression Region

1~199aa

Host

E. coli

Target

PRDX1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Natural killer cell-enhancing factor AProliferation-associated gene proteinThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2PAGA, PAGB, TDPX2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK14 Protein (N-His, Human)
P526624 100 µg

MAPK14 Protein (N-His, Human)

Sign In for Pricing
View Details
LOC289378-set siRNA/shRNA/RNAi Lentivector (Rat)
27085096 4x 500 ng

LOC289378-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Anti-HBD Antibody Picoband® (Dylight488 Conjugate)
A01076-Dylight488 100 µg

Anti-HBD Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Wasf2 (NM_153423) Mouse Tagged Lenti ORF Clone
MR224990L4 10 µg

Wasf2 (NM_153423) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-c-Fos (Ser362) Polyclonal Antibody, HRP Conjugated
bs-12910R-HRP-01 20 µL

Phospho-c-Fos (Ser362) Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Phospho-c-Fos (Ser362) Polyclonal Antibody, HRP Conjugated
bs-12910R-HRP-02 100 µL

Phospho-c-Fos (Ser362) Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details