Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-1 (PRDX1)

Recombinant Human Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PRDX1. Target Synonyms: Natural killer cell-enhancing factor AProliferation-associated gene proteinThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2PAGA, PAGB, TDPX2. Accession Number: Q06830. Expression Region: 1~199aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein.

Accession Number

Q06830

Expression Region

1~199aa

Host

E. coli

Target

PRDX1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Natural killer cell-enhancing factor AProliferation-associated gene proteinThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2PAGA, PAGB, TDPX2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC22A15 Knockout A549 cell line
GTR15403571 1 Vial

Human SLC22A15 Knockout A549 cell line

Sign In for Pricing
View Details
TNFAIP1 Rabbit Polyclonal Antibody
TA322230 100 µL

TNFAIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AQP4 (Z-1) P
sc-515965 P 100 µg - 0.5 mL

AQP4 (Z-1) P

Sign In for Pricing
View Details
Human CD63 Antigen (CD63) Protein
abx069261-01 10 µg

Human CD63 Antigen (CD63) Protein

Sign In for Pricing
View Details
Human CD63 Antigen (CD63) Protein
abx069261-02 50 µg

Human CD63 Antigen (CD63) Protein

Sign In for Pricing
View Details
Human CD63 Antigen (CD63) Protein
abx069261-03 100 µg

Human CD63 Antigen (CD63) Protein

Sign In for Pricing
View Details