Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-1 (PRDX1)

Recombinant Human Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PRDX1. Target Synonyms: Natural killer cell-enhancing factor AProliferation-associated gene proteinThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2PAGA, PAGB, TDPX2. Accession Number: Q06830. Expression Region: 1~199aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein.

Accession Number

Q06830

Expression Region

1~199aa

Host

E. coli

Target

PRDX1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

27.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Natural killer cell-enhancing factor AProliferation-associated gene proteinThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2PAGA, PAGB, TDPX2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Antibody to PKHD1
E10-30740T 100 µL

Rat Monoclonal Antibody to PKHD1

Sign In for Pricing
View Details
NAT8L Rabbit Polyclonal Antibody (BF350)
orb2542831 100 µL

NAT8L Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
IDDM11 Protein Vector (Human) (pPM-C-HA)
24169021 500 ng

IDDM11 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Connective tissue-activating Peptide III (CTAPIII) Human ELISA Kit
C5664 96 Tests

Connective tissue-activating Peptide III (CTAPIII) Human ELISA Kit

Sign In for Pricing
View Details
NaV1.7 inhibitor-1 5mg
A18933-5 5 mg

NaV1.7 inhibitor-1 5mg

Sign In for Pricing
View Details
Recombinant Danio rerio Probable E3 ubiquitin-protein ligase RNF144A-B (rnf144ab), partial
MBS7084264 Inquire

Recombinant Danio rerio Probable E3 ubiquitin-protein ligase RNF144A-B (rnf144ab), partial

Sign In for Pricing
View Details