Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Placenta growth factor (PGF)

Recombinant Human Placenta growth factor (PGF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PGF. Target Synonyms: D12S1900; Pgf; PGFL; PIGF; Placenta growth factor; Placental growth factor; Placental growth factor; vascular endothelial growth factor related protein; PlGF 2; PlGF; PLGF_HUMAN; PlGF2; SHGC 10760. Accession Number: P49763. Expression Region: 19~170aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Placenta growth factor (PGF) is a purified Recombinant Protein.

Accession Number

P49763

Expression Region

19~170aa

Host

E. coli

Target

PGF

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein of Isoform PlGF-2

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

D12S1900; Pgf; PGFL; PIGF; Placenta growth factor; Placental growth factor; Placental growth factor; vascular endothelial growth factor related protein; PlGF 2; PlGF; PLGF_HUMAN; PlGF2; SHGC 10760

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)
MBS1234231-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)
MBS1234231-02 0.02 mg (Yeast)

Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)
MBS1234231-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)
MBS1234231-04 0.1 mg (Yeast)

Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)
MBS1234231-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)
MBS1234231-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O127:H6 DNA ligase B (ligB)

Sign In for Pricing
View Details