Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Peptide deformylase (def)

Recombinant Staphylococcus aureus Peptide deformylase (def) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: def. Target Synonyms: Polypeptide deformylase. Accession Number: P68826. Expression Region: 1~183aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 36.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Peptide deformylase (def) is a purified Recombinant Protein.

Accession Number

P68826

Expression Region

1~183aa

Host

E. coli

Target

Def

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Polypeptide deformylase

Species

Staphylococcus aureus

Protein Name

Recombinant Protein

AA Sequence

MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp1r12c Mouse shRNA Lentiviral Particle (Locus ID 232807)
TL519541V 500 µL Each

Ppp1r12c Mouse shRNA Lentiviral Particle (Locus ID 232807)

Sign In for Pricing
View Details
Camel Endothelin 1, ET-1 ELISA Kit
SL0001Cm-01 48 Tests

Camel Endothelin 1, ET-1 ELISA Kit

Sign In for Pricing
View Details
Camel Endothelin 1, ET-1 ELISA Kit
SL0001Cm-02 96 Tests

Camel Endothelin 1, ET-1 ELISA Kit

Sign In for Pricing
View Details
NF-kB p65 (RELA) Rabbit Monoclonal Antibody [Clone ID: OTIR5D11]
TA594404 100 µL

NF-kB p65 (RELA) Rabbit Monoclonal Antibody [Clone ID: OTIR5D11]

Sign In for Pricing
View Details
P16 INK4A/CDKN2A Rabbit pAb
E2382495 100 µL

P16 INK4A/CDKN2A Rabbit pAb

Sign In for Pricing
View Details
PPP1R3D Protein Lysate (Mouse) with C-HA Tag
37456034 100 µg

PPP1R3D Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details