Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Peptide deformylase (def)

Recombinant Staphylococcus aureus Peptide deformylase (def) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: def. Target Synonyms: Polypeptide deformylase. Accession Number: P68826. Expression Region: 1~183aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 36.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Staphylococcus aureus Peptide deformylase (def) is a purified Recombinant Protein.

Accession Number

P68826

Expression Region

1~183aa

Host

E. coli

Target

Def

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

36.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Polypeptide deformylase

Species

Staphylococcus aureus

Protein Name

Recombinant Protein

AA Sequence

MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
37963111 3x 1.0 µg

PSMB7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Vom2r15 (NM_001099490) Rat Tagged Lenti ORF Clone
RR212851L3 10 µg

Vom2r15 (NM_001099490) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Apigenin-d5 7-Glucuronide
TRC-A726507-25MG 25 mg

Apigenin-d5 7-Glucuronide

Sign In for Pricing
View Details
LACTBL1 ORF Vector (Human) (pORF)
26262011 1.0 µg DNA

LACTBL1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal RPL5 Antibody [DyLight 680]
NBP2-22285FR 0.1 mL

Rabbit Polyclonal RPL5 Antibody [DyLight 680]

Sign In for Pricing
View Details
CK10 Rabbit Polyclonal Antibody (AP)
orb1597468 100 µL

CK10 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details