Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1)

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PCBD1. Target Synonyms: 4-alpha-hydroxy-tetrahydropterin dehydrataseDimerization cofactor of hepatocyte nuclear factor 1-alphaDCoHDimerization cofactor of HNF1Phenylalanine hydroxylase-stimulating proteinPterin carbinolamine dehydrataseDCOH, PCBD. Accession Number: P61457. Expression Region: 2~104aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 15.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1) is a purified Recombinant Protein.

Accession Number

P61457

Expression Region

2~104aa

Host

E. coli

Target

PCBD1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4-alpha-hydroxy-tetrahydropterin dehydrataseDimerization cofactor of hepatocyte nuclear factor 1-alphaDCoHDimerization cofactor of HNF1Phenylalanine hydroxylase-stimulating proteinPterin carbinolamine dehydrataseDCOH, PCBD

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAC32P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2479906 1.0 µg DNA

TRNAC32P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Biotinylated Recombinant Equine Frizzled Class Receptor 8 (FZD8), C-6His-Avi
AP2F293 100 µg

Biotinylated Recombinant Equine Frizzled Class Receptor 8 (FZD8), C-6His-Avi

Sign In for Pricing
View Details
Lentiviral mouse Klra5 shRNA (UAS) - Lentiviral mouse Klra5 shRNA (UAS) (100)
GTR15137634 1 Vial

Lentiviral mouse Klra5 shRNA (UAS) - Lentiviral mouse Klra5 shRNA (UAS) (100)

Sign In for Pricing
View Details
F10 Protein Lysate (Human) with C-Ha Tag
19605031 100 µg

F10 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Amyloid Beta, 1-40, 42 (CT) (Amyloid A4)
MBS632447-01 0.1 mg

Amyloid Beta, 1-40, 42 (CT) (Amyloid A4)

Sign In for Pricing
View Details
Amyloid Beta, 1-40, 42 (CT) (Amyloid A4)
MBS632447-02 5x 0.1 mg

Amyloid Beta, 1-40, 42 (CT) (Amyloid A4)

Sign In for Pricing
View Details