Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1)

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PCBD1. Target Synonyms: 4-alpha-hydroxy-tetrahydropterin dehydrataseDimerization cofactor of hepatocyte nuclear factor 1-alphaDCoHDimerization cofactor of HNF1Phenylalanine hydroxylase-stimulating proteinPterin carbinolamine dehydrataseDCOH, PCBD. Accession Number: P61457. Expression Region: 2~104aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 15.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Pterin-4-alpha-carbinolamine dehydratase (PCBD1) is a purified Recombinant Protein.

Accession Number

P61457

Expression Region

2~104aa

Host

E. coli

Target

PCBD1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Epigenetics, Nuclear Signaling

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4-alpha-hydroxy-tetrahydropterin dehydrataseDimerization cofactor of hepatocyte nuclear factor 1-alphaDCoHDimerization cofactor of HNF1Phenylalanine hydroxylase-stimulating proteinPterin carbinolamine dehydrataseDCOH, PCBD

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia burgdorferi UPF0073 membrane protein BB_0117 (BB_0117)
MBS7036778-01 0.02 mg

Recombinant Borrelia burgdorferi UPF0073 membrane protein BB_0117 (BB_0117)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi UPF0073 membrane protein BB_0117 (BB_0117)
MBS7036778-02 0.1 mg

Recombinant Borrelia burgdorferi UPF0073 membrane protein BB_0117 (BB_0117)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi UPF0073 membrane protein BB_0117 (BB_0117)
MBS7036778-03 5x 0.1 mg

Recombinant Borrelia burgdorferi UPF0073 membrane protein BB_0117 (BB_0117)

Sign In for Pricing
View Details
Mouse MMP-24 (MT5-MMP) MAb (Clone 143908)
MAB924-SP 25 µg

Mouse MMP-24 (MT5-MMP) MAb (Clone 143908)

Sign In for Pricing
View Details
APBB1IP 3'UTR GFP Stable Cell Line
TU050930 1.0 mL

APBB1IP 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Phospho-CDK1/2/3 (T14) Rabbit Monoclonal Antibody
E46F1641 40 µL

Phospho-CDK1/2/3 (T14) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details