Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase parkin (PRKN)

Recombinant Human E3 ubiquitin-protein ligase parkin (PRKN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PRKN. Target Synonyms: Parkinson juvenile disease protein 2; Parkinson disease protein 2. Accession Number: O60260. Expression Region: 1~465aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 67.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human E3 ubiquitin-protein ligase parkin (PRKN) is a purified Recombinant Protein.

Accession Number

O60260

Expression Region

1~465aa

Host

E. coli

Target

PRKN

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Apoptosis

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

67.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Parkinson juvenile disease protein 2; Parkinson disease protein 2

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-100 1x 100 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-500 1x 500 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-100 1x 100 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details