Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glycodelin (PAEP)

Recombinant Human Glycodelin (PAEP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: PAEP. Target Synonyms: Placental protein 14PP14Pregnancy-associated endometrial alpha-2 globulinPAEGPEGProgestagen-associated endometrial proteinProgesterone-associated endometrial protein. Accession Number: P09466. Expression Region: 19~180aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 22.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Glycodelin (PAEP) is a purified Recombinant Protein.

Accession Number

P09466

Expression Region

19~180aa

Host

E. coli

Target

PAEP

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged

Field of Research

Tags & Cell Markers

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Placental protein 14PP14Pregnancy-associated endometrial alpha-2 globulinPAEGPEGProgestagen-associated endometrial proteinProgesterone-associated endometrial protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CALCRL Antibody (SAA0150)
MBS1564469-01 0.05 mg

Anti-Human CALCRL Antibody (SAA0150)

Sign In for Pricing
View Details
Anti-Human CALCRL Antibody (SAA0150)
MBS1564469-02 0.1 mg

Anti-Human CALCRL Antibody (SAA0150)

Sign In for Pricing
View Details
Anti-Human CALCRL Antibody (SAA0150)
MBS1564469-03 5x 0.1 mg

Anti-Human CALCRL Antibody (SAA0150)

Sign In for Pricing
View Details
Recombinant Shigella Sonnei kdsB Protein (aa 1-248)
VAng-Lsx09810-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei kdsB Protein (aa 1-248)

Sign In for Pricing
View Details
EPB41L1 Rabbit Polyclonal Antibody (Fluoro647)
orb3078576 100 µg

EPB41L1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Melanoma Associated Antigen 100+ / 7 kDa Antibody [G24P23]
C20562-50uL 50 μL

Melanoma Associated Antigen 100+ / 7 kDa Antibody [G24P23]

Sign In for Pricing
View Details