Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Oncomodulin (Ocm)

Recombinant Mouse Oncomodulin (Ocm) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Ocm. Target Synonyms: Parvalbumin beta. Accession Number: P51879. Expression Region: 2~109aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 28.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Oncomodulin (Ocm) is a purified Recombinant Protein.

Accession Number

P51879

Expression Region

2~109aa

Host

E. coli

Target

Ocm

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Neuroscience

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

28.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Parvalbumin beta

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HHV8 ORF50 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-0860R-BF488 100 µL

HHV8 ORF50 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
GST-Tagged Recombinant Protein Purification Column
20170003-3 10 mL

GST-Tagged Recombinant Protein Purification Column

Sign In for Pricing
View Details
Zebrafish PHYHIPL/b Rabbit Polyclonal Antibody (Biotin)
orb2817728 100 µg

Zebrafish PHYHIPL/b Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Ribose-phosphate pyrophosphokinase (prs)
MBS1439806-01 0.02 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Ribose-phosphate pyrophosphokinase (prs)
MBS1439806-02 0.02 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Ribose-phosphate pyrophosphokinase (prs)
MBS1439806-03 0.1 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details