Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuroglobin (NGB)

Recombinant Human Neuroglobin (NGB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: NGB. Target Synonyms: Neuroglobin; NGB; NGB_HUMAN. Accession Number: Q9NPG2. Expression Region: 1~151aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Neuroglobin (NGB) is a purified Recombinant Protein.

Accession Number

Q9NPG2

Expression Region

1~151aa

Host

E. coli

Target

NGB

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Transport

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Neuroglobin; NGB; NGB_HUMAN

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pU6-SYNCRIP-shRNA1-Puro Plasmid
PVT53594 2 µg

pU6-SYNCRIP-shRNA1-Puro Plasmid

Sign In for Pricing
View Details
ATP5O, NT (ATP Synthase Subunit O, Mitochondrial, Oligomycin Sensitivity Conferral Protein, OSCP, ATP5O) (Azide free) (HRP)
MBS6464379-01 0.2 mL

ATP5O, NT (ATP Synthase Subunit O, Mitochondrial, Oligomycin Sensitivity Conferral Protein, OSCP, ATP5O) (Azide free) (HRP)

Sign In for Pricing
View Details
ATP5O, NT (ATP Synthase Subunit O, Mitochondrial, Oligomycin Sensitivity Conferral Protein, OSCP, ATP5O) (Azide free) (HRP)
MBS6464379-02 5x 0.2 mL

ATP5O, NT (ATP Synthase Subunit O, Mitochondrial, Oligomycin Sensitivity Conferral Protein, OSCP, ATP5O) (Azide free) (HRP)

Sign In for Pricing
View Details
FAM92A1 (h) -PR
sc-77502-PR 10 µM - 20 µL

FAM92A1 (h) -PR

Sign In for Pricing
View Details
Lentiviral human POLR2H sgRNA gene knockout kit - Lentiviral human POLR2H sgRNA gene knockout kit (plasmid)
GTR15376325 1 Vial

Lentiviral human POLR2H sgRNA gene knockout kit - Lentiviral human POLR2H sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PD-L1 (3B11) Monoclonal Antibody, PE-Cy7 Conjugated
bsm-43073M-PE-Cy7 100 µL

PD-L1 (3B11) Monoclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details