Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Napsin-A (NAPSA)

Recombinant Human Napsin-A (NAPSA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: NAPSA. Target Synonyms: Aspartyl protease 4; ASP4; Asp 4Napsin-1TA01/TA02. Accession Number: O96009. Expression Region: 64~420aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 42.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Napsin-A (NAPSA) is a purified Recombinant Protein.

Accession Number

O96009

Expression Region

64~420aa

Host

E. coli

Target

NAPSA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aspartyl protease 4; ASP4; Asp 4Napsin-1TA01/TA02

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf26 CRISPRa sgRNA lentivector (set of three targets)(Human)
14470121 3x 1.0µg DNA

C3orf26 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human G0S2 / G0/G1 switch protein 2 ELISA Kit
MBS2905332-01 48 Well

Human G0S2 / G0/G1 switch protein 2 ELISA Kit

Sign In for Pricing
View Details
Human G0S2 / G0/G1 switch protein 2 ELISA Kit
MBS2905332-02 96 Well

Human G0S2 / G0/G1 switch protein 2 ELISA Kit

Sign In for Pricing
View Details
Human G0S2 / G0/G1 switch protein 2 ELISA Kit
MBS2905332-03 5x 96 Well

Human G0S2 / G0/G1 switch protein 2 ELISA Kit

Sign In for Pricing
View Details
Human G0S2 / G0/G1 switch protein 2 ELISA Kit
MBS2905332-04 10x 96 Well

Human G0S2 / G0/G1 switch protein 2 ELISA Kit

Sign In for Pricing
View Details
HSP90 alpha Mouse mAb, Pacific Blue conjugated
orb2865521 100 µL

HSP90 alpha Mouse mAb, Pacific Blue conjugated

Sign In for Pricing
View Details