Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Napsin-A (NAPSA)

Recombinant Human Napsin-A (NAPSA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: NAPSA. Target Synonyms: Aspartyl protease 4; ASP4; Asp 4Napsin-1TA01/TA02. Accession Number: O96009. Expression Region: 64~420aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 42.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Napsin-A (NAPSA) is a purified Recombinant Protein.

Accession Number

O96009

Expression Region

64~420aa

Host

E. coli

Target

NAPSA

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Tagged

Field of Research

Cell Biology

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Aspartyl protease 4; ASP4; Asp 4Napsin-1TA01/TA02

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAV8 Rabbit Monoclonal Antibody [Clone ID: OTIR1C10]
TA594407 100 µL

AAV8 Rabbit Monoclonal Antibody [Clone ID: OTIR1C10]

Sign In for Pricing
View Details
PAX2 Antibody Pair
orb1678476 1 pair (5 x 96 T?1080.0

PAX2 Antibody Pair

Sign In for Pricing
View Details
GRAP2 (NM_001291828) Human Untagged Clone
SC334543 10 µg

GRAP2 (NM_001291828) Human Untagged Clone

Sign In for Pricing
View Details
TUBBP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV754880 1.0 µg DNA

TUBBP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
ARF GTPase Activating Protein GIT1 (GIT1) Antibody (ATTO488)
abx440454 100 µg

ARF GTPase Activating Protein GIT1 (GIT1) Antibody (ATTO488)

Sign In for Pricing
View Details
COG4 (Conserved Oligomeric Golgi Complex Subunit 4, COG Complex Subunit 4, Component of Oligomeric Golgi Complex 4, COG4)
406272-01 50 µL

COG4 (Conserved Oligomeric Golgi Complex Subunit 4, COG Complex Subunit 4, Component of Oligomeric Golgi Complex 4, COG4)

Sign In for Pricing
View Details