Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Myoglobin (Mb)

Recombinant Mouse Myoglobin (Mb) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Mb. Target Synonyms: Mb; Myoglobin. Accession Number: P04247. Expression Region: 2~154aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 21.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Mouse Myoglobin (Mb) is a purified Recombinant Protein.

Accession Number

P04247

Expression Region

2~154aa

Host

E. coli

Target

Mb

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged

Field of Research

Cardiovascular

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

21.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Mb; Myoglobin

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Putative small intestine sodium-dependent phosphate transport protein (SLC17A4) Mouse ELISA Kit
G5568 96 Tests

Putative small intestine sodium-dependent phosphate transport protein (SLC17A4) Mouse ELISA Kit

Sign In for Pricing
View Details
MAGEB1 CRISPRa sgRNA lentivector (set of three targets)(Human)
27924121 3x 1.0µg DNA

MAGEB1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
IGFBP-1 (Insulin Like Growth Factor Binding Protein 1) BioAssayTM ELISA Kit (Chicken) discontinued
356540-01 48 Tests

IGFBP-1 (Insulin Like Growth Factor Binding Protein 1) BioAssayTM ELISA Kit (Chicken) discontinued

Sign In for Pricing
View Details
IGFBP-1 (Insulin Like Growth Factor Binding Protein 1) BioAssayTM ELISA Kit (Chicken) discontinued
356540-02 96 Tests

IGFBP-1 (Insulin Like Growth Factor Binding Protein 1) BioAssayTM ELISA Kit (Chicken) discontinued

Sign In for Pricing
View Details
Carbonic Anhydrase II (CA2) (NM_000067) Human Tagged Lenti ORF Clone
RC201974L3 10 µg

Carbonic Anhydrase II (CA2) (NM_000067) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PRAK (MAPKAPK5) (NM_003668) Human Tagged ORF Clone
RC216715 10 µg

PRAK (MAPKAPK5) (NM_003668) Human Tagged ORF Clone

Sign In for Pricing
View Details