Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: LY6G6D. Target Synonyms: Megakaryocyte-enhanced gene transcript 1 protein. Accession Number: O95868. Expression Region: 10~104aa. Tag Info: N-Terminal 10Xhis-B2M-Jd-Tagged. Theoretical MW: 15.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial is a purified Recombinant Protein.

Accession Number

O95868

Expression Region

10~104aa

Host

E. coli

Target

LY6G6D

Conjugation

Unconjugated

Tag

N-Terminal 10Xhis-B2M-Jd-Tagged

Field of Research

Signal Transduction

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Partial

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Megakaryocyte-enhanced gene transcript 1 protein

Species

Human (Homo sapiens)

Protein Name

Recombinant Protein

AA Sequence

LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPA0 (NM_006805) Human Over-expression Lysate
E45H08369-2 20 µg

HNRNPA0 (NM_006805) Human Over-expression Lysate

Sign In for Pricing
View Details
IGF2R Peptide
AF6939-BP 1 mg

IGF2R Peptide

Sign In for Pricing
View Details
RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3, FLJ31455, RP11-3J10.9, bA3J10.9)
588675 50 µg

RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3, FLJ31455, RP11-3J10.9, bA3J10.9)

Sign In for Pricing
View Details
FGF 23 (FGF23) Rabbit Monoclonal Antibody [Clone ID: OTIR5D11]
TA592951S 30 µL

FGF 23 (FGF23) Rabbit Monoclonal Antibody [Clone ID: OTIR5D11]

Sign In for Pricing
View Details
Lentiviral mouse St8sia2 shRNA (UAS) - Lentiviral mouse St8sia2 shRNA (UAS, iRFP) plasmid
GTR15211060 1 Vial

Lentiviral mouse St8sia2 shRNA (UAS) - Lentiviral mouse St8sia2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Hmmr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6803405 3x 1.0 µg

Hmmr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details